PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19427s0048.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 275aa    MW: 29948.7 Da    PI: 8.067
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19427s0048.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-18112166256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ ++tkeq   Lee F+ +++++ ++++ LA++l+L+ rqV vWFqNrRa+ k
  Bostr.19427s0048.1.p 112 RKKLRLTKEQSALLEESFKHHSTLNPKQKKVLARQLNLKPRQVEVWFQNRRARTK 166
                           788899***********************************************98 PP

2HD-ZIP_I/II123.97.6e-40112201191
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rl+keq++lLEesF+++++L+p++K+ lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en rL+ke +eL+ 
  Bostr.19427s0048.1.p 112 RKKLRLTKEQSALLEESFKHHSTLNPKQKKVLARQLNLKPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENMRLQKEIQELK- 199
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 el 91 
                           +l
  Bostr.19427s0048.1.p 200 TL 201
                           54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.054108168IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-17109171IPR009057Homeodomain-like
SMARTSM003891.0E-15110172IPR001356Homeobox domain
SuperFamilySSF466892.14E-18110176IPR009057Homeodomain-like
PfamPF000468.4E-16112166IPR001356Homeobox domain
CDDcd000863.53E-17112169No hitNo description
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PfamPF021831.7E-9168201IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.5E-23168211IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGFDDSCNTG LVLGLGLSTT PTNYNNVIKR SSGYKLEPSL TLSLSGDPSF TVVTGPDQLS  60
RQTSSHSGVS SFSSGRVVKR ERDGGEESPE EEDTTERVIS DYHEDEEGVS ARKKLRLTKE  120
QSALLEESFK HHSTLNPKQK KVLARQLNLK PRQVEVWFQN RRARTKLKQT EVDCEFLKKC  180
CETLTDENMR LQKEIQELKT LKLTHLPFYM HMPASTLTMC PSCERIGAGG GNGGGGGGSV  240
ATAVVVDGGT AKGAFSISSK PHFFNPFTNP SAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160168RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2292180.0AK229218.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL16-50-N10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880460.11e-168homeobox-leucine zipper protein 9
SwissprotP466031e-152HAT9_ARATH; Homeobox-leucine zipper protein HAT9
TrEMBLD7LE401e-168D7LE40_ARALL; Homeobox-leucine zipper protein 9
STRINGfgenesh2_kg.4__202__AT2G22800.11e-167(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22800.11e-124HD-ZIP family protein